PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00131074001
Common NameGSBRNA2T00131074001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 323aa    MW: 36299.9 Da    PI: 7.0373
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00131074001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-31188242256
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          +r+rW++eLH++Fv+a+++LGGs++AtPk+i+++mkv+gLt+++vkSHLQkYR++
  GSBRNA2T00131074001 188 QRRRWSQELHRKFVDALHSLGGSQVATPKQIRDMMKVDGLTNDEVKSHLQKYRMH 242
                          8****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-27184245IPR009057Homeodomain-like
PROSITE profilePS5129412.256184244IPR017930Myb domain
SuperFamilySSF466893.14E-17185245IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-24188242IPR006447Myb domain, plants
PfamPF002499.6E-8189240IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MVQTGTDKMG LNLNLSMYSL AKPLSQFLDE VSRIKDYDSK LSEIDGYVGK LEEERKKIDV  60
FKRELPLCML LLNEAIETLK EEASSSVVMA SDGKLDVGEG AKVESDNKKN WMSSAQLWIS  120
NPNSQLQSTN EKEDRSVTHK PIQGGAFTSF NLPPAPLSLR TPTSEILMDY NHQFSKPMQS  180
LHSQKKEQRR RWSQELHRKF VDALHSLGGS QVATPKQIRD MMKVDGLTND EVKSHLQKYR  240
MHIRKHPAKT LSSSDQPVVL DKETQSLISL TRSDSPQSPL IDGGLFSNNG HSSEEAEDEE  300
KSDGRSWRSV SNKKKQGLDL EL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.93250.0seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00131074001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ9738390.0DQ973839.1 Brassica napus clone PBCESTNA15 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013617177.10.0PREDICTED: uncharacterized protein LOC106323631
TrEMBLA0A078BZ600.0A0A078BZ60_BRANA; BnaC01g01940D protein
STRINGBra011720.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-149G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]